Loading...
Statistics
Advertisement

Celebrating You | Mercy Health System
www.celebratingyou.info/
Be sure to visit Mercy's Ambassador Program online!

Celebratingyou.info

Advertisement
Conversion Technology Metas Server
Celebratingyou.info is hosted in United States / Houston . Celebratingyou.info uses HTTPS protocol. Number of used technologies: 12. First technologies: CSS, Fancybox, Google Font API, Number of used javascripts: 18. First javascripts: Jquery.js, Jquery-migrate.min.js, Jquery.cycle.all.js, Number of used analytics tools: 2. First analytics tools: Google Analytics, WordPress Stats, Number of used plugins, modules: 3. Its server type is: nginx/1.10.1. Its CMS is: Wordpress.

Technologies in use by Celebratingyou.info

Technology

Number of occurences: 12
  • CSS
  • Fancybox
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • jQuery
  • jQuery Cycle
  • jQuery Fancybox
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 18
  • jquery.js
  • jquery-migrate.min.js
  • jquery.cycle.all.js
  • jquery.metadata.v2.js
  • jquery.touchwipe.1.1.1.js
  • slideshow.js
  • jquery.min.js
  • jquery.fancybox.js
  • jquery.fancybox-buttons.js
  • jquery.fancybox-thumbs.js
  • jquery.easing-1.3.pack.js
  • jquery.mousewheel-3.0.6.pack.js
  • comment-reply.min.js
  • devicepx-jetpack.js
  • gprofiles.js
  • wpgroho.js
  • wp-embed.min.js
  • e-201629.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 2
  • Google Analytics
  • WordPress Stats

Server Type

  • nginx/1.10.1

Used plugins, modules

Number of plugins and modules: 3
  • meteor slides
  • jetpack
  • wpgroho.js?ver=4.5.3 http:

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Celebratingyou.info

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.websitewelcome.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HostGator.com, LLC.
        • 2: PositiveSSL Wildcard
      • CN: *.websitewelcome.com
    • hash: b86b2c33
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 73802823338622261546480845931487065049
    • validFrom: 151016000000Z
    • validTo: 181015235959Z
    • validFrom_time_t: 1444953600
    • validTo_time_t: 1539647999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 11:37:8F:56:DC:AF:E0:18:CB:07:A7:02:00:3C:DE:8C:B8:11:F4:3A
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.websitewelcome.com, DNS:websitewelcome.com

Meta - Celebratingyou.info

Number of occurences: 5
  • Name:
    Content: en_US
  • Name: description
    Content: Be sure to visit Mercy's Ambassador Program online!
  • Name: robots
    Content: noodp
  • Name: generator
    Content: WordPress 4.5.3
  • Name: twitter:card
    Content: summary

Server / Hosting

  • IP: 192.185.120.93
  • Latitude: 29.83
  • Longitude: -95.47
  • Country: United States
  • City: Houston

Rname

  • ns1584.websitewelcome.com
  • ns1583.websitewelcome.com
  • celebratingyou.info

Target

  • root.yulon.websitewelcome.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx/1.10.1 Date: Fri, 22 Jul 2016 05:39:00 GMT Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Pingback: http://celebratingyou.info/xmlrpc.php Location: http://celebratingyou.info/ X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Fri, 22 Jul 2016 05:39:01 GMT Content-Type: text/html; charset=UTF-8 X-Pingback: http://celebratingyou.info/xmlrpc.php Link: ; rel="https://api.w.org/", ; rel=shortlink X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Transfer-Encoding: chunked Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

DNS

host: celebratingyou.info
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 192.185.120.93
host: celebratingyou.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1584.websitewelcome.com
host: celebratingyou.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1583.websitewelcome.com
host: celebratingyou.info
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1583.websitewelcome.com
  5. rname: root.yulon.websitewelcome.com
  6. serial: 2016013100
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: celebratingyou.info
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: celebratingyou.info
host: celebratingyou.info
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx include:websitewelcome.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.elebratingyou.info, www.cdelebratingyou.info, www.delebratingyou.info, www.crelebratingyou.info, www.relebratingyou.info, www.ctelebratingyou.info, www.telebratingyou.info, www.cvelebratingyou.info, www.velebratingyou.info, www.cfelebratingyou.info, www.felebratingyou.info, www.cgelebratingyou.info, www.gelebratingyou.info, www.chelebratingyou.info, www.helebratingyou.info, www.cnelebratingyou.info, www.nelebratingyou.info, www.cmelebratingyou.info, www.melebratingyou.info, www.cjelebratingyou.info, www.jelebratingyou.info, www.clebratingyou.info, www.cexlebratingyou.info, www.cxlebratingyou.info, www.ceslebratingyou.info, www.cslebratingyou.info, www.cewlebratingyou.info, www.cwlebratingyou.info, www.cerlebratingyou.info, www.crlebratingyou.info, www.ceflebratingyou.info, www.cflebratingyou.info, www.cevlebratingyou.info, www.cvlebratingyou.info, www.ceclebratingyou.info, www.cclebratingyou.info, www.ceqlebratingyou.info, www.cqlebratingyou.info, www.cealebratingyou.info, www.calebratingyou.info, www.ceylebratingyou.info, www.cylebratingyou.info, www.ceebratingyou.info, www.celuebratingyou.info, www.ceuebratingyou.info, www.cel8ebratingyou.info, www.ce8ebratingyou.info, www.cel9ebratingyou.info, www.ce9ebratingyou.info, www.celjebratingyou.info, www.cejebratingyou.info, www.cel0ebratingyou.info, www.ce0ebratingyou.info, www.celmebratingyou.info, www.cemebratingyou.info, www.celpebratingyou.info, www.cepebratingyou.info, www.celoebratingyou.info, www.ceoebratingyou.info, www.celbratingyou.info, www.celexbratingyou.info, www.celxbratingyou.info, www.celesbratingyou.info, www.celsbratingyou.info, www.celewbratingyou.info, www.celwbratingyou.info, www.celerbratingyou.info, www.celrbratingyou.info, www.celefbratingyou.info, www.celfbratingyou.info, www.celevbratingyou.info, www.celvbratingyou.info, www.celecbratingyou.info, www.celcbratingyou.info, www.celeqbratingyou.info, www.celqbratingyou.info, www.celeabratingyou.info, www.celabratingyou.info, www.celeybratingyou.info, www.celybratingyou.info, www.celeratingyou.info, www.celebqratingyou.info, www.celeqratingyou.info, www.celebwratingyou.info, www.celewratingyou.info, www.celebzratingyou.info, www.celezratingyou.info, www.celebxratingyou.info, www.celexratingyou.info, www.celebratingyou.info, www.celeratingyou.info, www.celebsratingyou.info, www.celesratingyou.info, www.celebyratingyou.info, www.celeyratingyou.info, www.celeberatingyou.info, www.celeeratingyou.info, www.celebdratingyou.info, www.celedratingyou.info, www.celebcratingyou.info, www.celecratingyou.info, www.celebatingyou.info, www.celebriatingyou.info, www.celebiatingyou.info, www.celebroatingyou.info, www.celeboatingyou.info, www.celebrlatingyou.info, www.celeblatingyou.info, www.celebrlatingyou.info, www.celeblatingyou.info, www.celebr.atingyou.info, www.celeb.atingyou.info, www.celebrtingyou.info, www.celebraotingyou.info, www.celebrotingyou.info, www.celebraptingyou.info, www.celebrptingyou.info, www.celebra9tingyou.info, www.celebr9tingyou.info, www.celebratingyou.info, www.celebrtingyou.info, www.celebraitingyou.info, www.celebritingyou.info, www.celebrautingyou.info, www.celebrutingyou.info, www.celebraingyou.info, www.celebratqingyou.info, www.celebraqingyou.info, www.celebrataingyou.info, www.celebraaingyou.info, www.celebrat ingyou.info, www.celebra ingyou.info, www.celebratwingyou.info, www.celebrawingyou.info, www.celebrateingyou.info, www.celebraeingyou.info, www.celebratzingyou.info, www.celebrazingyou.info, www.celebratxingyou.info, www.celebraxingyou.info, www.celebratcingyou.info, www.celebracingyou.info, www.celebratngyou.info, www.celebratirngyou.info, www.celebratrngyou.info, www.celebratifngyou.info, www.celebratfngyou.info, www.celebrativngyou.info, www.celebratvngyou.info, www.celebratikngyou.info, www.celebratkngyou.info, www.celebrati,ngyou.info, www.celebrat,ngyou.info, www.celebratibngyou.info, www.celebratbngyou.info, www.celebratigngyou.info, www.celebratgngyou.info, www.celebratitngyou.info, www.celebrattngyou.info, www.celebratiyngyou.info, www.celebratyngyou.info, www.celebratiungyou.info, www.celebratungyou.info, www.celebratijngyou.info, www.celebratjngyou.info, www.celebratimngyou.info, www.celebratmngyou.info, www.celebratinngyou.info, www.celebratnngyou.info,

Other websites we recently analyzed

  1. Huard et compagnie
    Établir un excellent service à notre clientèle, et ce, avant et après vente afin de développer une relation durable avec les clients, basée principalement sur la confiance.
    Absecon (United States) - 97.107.130.147
    G Analytics ID: UA-440827-45
    Server software: Apache
    Technology: CSS, Flexslider, Html, Html5, Javascript, Schema.org, Google Analytics, Facebook Box
    Number of Javascript: 10
    Number of meta tags: 8
  2. moneylink24.org
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. westvirginiacarwrecklawyer.info
    Scottsdale (United States) - 184.168.221.52
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. Мужская, женская обувь оптом, сумки оптом, тапочки оптом
    Поставляем обувь оптом, женские сумки оптом, тапочки оптом, женская обувь оптом, мужская обувь оптом, домашняя обувь оптом, резиновая обувь оптом, Обувь Инблу ( INBLU ), NOKIAN финская обувь.
    Russian Federation - 195.144.251.230
    Server software: nginx/1.2.4
    Technology: AJAX Libraries API, CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Yandex.Metrika
    Number of Javascript: 10
    Number of meta tags: 7
  5. Sekai Ichi Indonesia MLM | Sekaichi Indonesia
    MLM Sekai Ichi Indonesia, Peluang Bisnis Sekaichi Indonesia, Dicari Leader di Seluruh Indonesia!
    Houston (United States) - 192.185.225.29
    Server software: nginx/1.8.1
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
    Number of Javascript: 1
    Number of meta tags: 5
  6. Equus Foods - Cinque Olive Oil
    Established in 2007, Equus Foods is a family-owned and operated importer and distributor of artisan produced organic and gourmet foods. We pride ourselves in supplier our clients with only the finest natural and organic gourmet products available from around the world.
    Sunnyvale (United States) - 67.195.61.46
    Server software: ATS/5.3.0
    Technology: CSS, Html, Javascript, Php, Lexity
    Number of Javascript: 1
    Number of meta tags: 5
  7. Superpole Exhausts | Superkwaliteit van fabrikant naar klant
    Superpole produceert schitterende dempers voor de echte motorliefhebber. Daarnaast kun je er terecht voor; motor accessoires, onderhoud service, circuit service en bandenservice.
    Netherlands - 5.157.84.25
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, jQuery Colorbox, jQuery Cycle, Php, Google Analytics, Drupal, Facebook Like box
    Number of Javascript: 7
    Number of meta tags: 6
  8. Õîñòèíã Îáûêíîâåííûé, áåñïëàòíî: Ñòðàíèöà íå íàéäåíà
    Íåäîðîãîé èëè áåñïëàòíûé õîñòèíã: 1 Ãá, Perl, PHP, MySQL, SSI, Python. Íåäîðîãîé vps.
    Ukraine - 91.228.146.12
    Server software: Apache/2.4.23 (FreeBSD)
    Technology: Google Adsense, CSS, Javascript, Php, Rambler
    Number of Javascript: 1
    Number of meta tags: 2
  9. cadbrothers.com
    Road Town (Virgin Islands, British) - 208.91.197.44
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  10. Kein Inhalt
    Germany - 144.76.213.4
    Server software: Apache/2.2.22 (Debian)
    Technology: CSS, Google Font API, Html, Html5
    Number of Javascript: 5
    Number of meta tags: 4

Check Other Websites